Classified by application

Screening Libraries

Building Blocks and Intermediates

Bioactive Small Molecules

Dye and Bio-assay Reagents

Impurities

Natural Products

Isotope Compounds

Reference compound

Intermediate

Peptides

Impurity

Others

CS-0302
Glucagon receptor antagonists-2
  • Cat. No.: 

    CS-0302
  • CAS No.: 

    202917-18-8
CS-0303
Glucagon receptor antagonists-3
  • Cat. No.: 

    CS-0303
  • CAS No.: 

    202917-17-7
CS-0301
Glucagon receptor antagonists-1
  • Cat. No.: 

    CS-0301
  • CAS No.: 

    503559-84-0
CS-5665
Glucagon receptor antagonists-4
  • Cat. No.: 

    CS-5665
  • CAS No.: 

    1393124-08-7
CS-5729
Adomeglivant
  • Cat. No.: 

    CS-5729
  • CAS No.: 

    1488363-78-5
CS-6006
GRA Ex-25
  • Cat. No.: 

    CS-6006
  • CAS No.: 

    307983-31-9
CS-0324
MK 0893
  • Cat. No.: 

    CS-0324
  • CAS No.: 

    870823-12-4
CS-6449
LGD-6972
  • Cat. No.: 

    CS-6449
  • CAS No.: 

    1207989-09-0
CS-8038
HAEGTFT
  • Cat. No.: 

    CS-8038
  • CAS No.: 

CS-8036
HAEGTFTSD
  • Cat. No.: 

    CS-8036
  • CAS No.: 

CS-8061
HAEGTFTSDVS
  • Cat. No.: 

    CS-8061
  • CAS No.: 

CS-7691
GLP-2(1-33)(human)
  • Cat. No.: 

    CS-7691
  • CAS No.: 

    223460-79-5
CS-8060
KQMEEEAVRLFIEWLKNGGPSSGAPPPS
  • Cat. No.: 

    CS-8060
  • CAS No.: 

CS-6174
Taspoglutide
  • Cat. No.: 

    CS-6174
  • CAS No.: 

    275371-94-3
CS-5975
GLP-1(7-37)
  • Cat. No.: 

    CS-5975
  • CAS No.: 

    106612-94-6
CS-7013
Exendin 9-39
  • Cat. No.: 

    CS-7013
  • CAS No.: 

    133514-43-9
CS-8039
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
  • Cat. No.: 

    CS-8039
  • CAS No.: 

CS-4545
Liraglutide
  • Cat. No.: 

    CS-4545
  • CAS No.: 

    204656-20-2
CS-8051
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
  • Cat. No.: 

    CS-8051
  • CAS No.: 

CS-1174
Exendin-4
  • Cat. No.: 

    CS-1174
  • CAS No.: 

    141758-74-9